PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI02G06760.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 301aa    MW: 32322.2 Da    PI: 8.6251
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI02G06760.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.76.3e-191156147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEde l ++v+++G ++W++I r ++ gR++k+c++rw + 
  ORUFI02G06760.1 11 KGPWSPEEDEALRRLVERHGARNWTAIGRGIP-GRSGKSCRLRWCNQ 56
                     79******************************.***********985 PP

2Myb_DNA-binding54.72.3e-1763106146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r ++T+eEd  +++a+++lG++ W++Iar ++ gRt++ +k++w++
  ORUFI02G06760.1  63 RRPFTAEEDAAILRAHARLGNR-WAAIARLLP-GRTDNAVKNHWNS 106
                      679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.481661IPR017930Myb domain
SuperFamilySSF466891.72E-318104IPR009057Homeodomain-like
SMARTSM007179.6E-171059IPR001005SANT/Myb domain
PfamPF002493.9E-181156IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.6E-251264IPR009057Homeodomain-like
CDDcd001673.81E-161355No hitNo description
SMARTSM007174.6E-1662110IPR001005SANT/Myb domain
PfamPF002493.6E-1563106IPR001005SANT/Myb domain
PROSITE profilePS5129421.39563112IPR017930Myb domain
CDDcd001677.71E-1365108No hitNo description
Gene3DG3DSA:1.10.10.605.7E-2465112IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MGMEAECDRI KGPWSPEEDE ALRRLVERHG ARNWTAIGRG IPGRSGKSCR LRWCNQLSPQ  60
VERRPFTAEE DAAILRAHAR LGNRWAAIAR LLPGRTDNAV KNHWNSSLKR KLATATDGGE  120
IDRPCKRVSP GPGSPTGSER SELSHGGCGS GSGGGQVFRP VPRPGGFDAI SAADVVRPPR  180
RRDDNDDDGD DDPLTSLSLS LSLPGFHHDS ARSHFQELPS PSRSPSPPPS PPAASPSAYP  240
FNADLVSAMQ EMIRTEVRNY MAGVGLRAGC GPGAVAESFM PQLVDGVMRA AAERVGVVTR  300
Q
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-4181144110B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00653PBMTransfer from LOC_Os02g09480Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0039900.0AP003990.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OJ1073_F05.
GenBankAP0040460.0AP004046.2 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OJ1145_F01.
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623498.10.0PREDICTED: transcription factor MYB44
SwissprotQ9FDW18e-67MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A0D9YNG70.0A0A0D9YNG7_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0G2Z70.0A0A0E0G2Z7_ORYNI; Uncharacterized protein
TrEMBLA0A0E0NAY10.0A0A0E0NAY1_ORYRU; Uncharacterized protein
TrEMBLQ6ZHS50.0Q6ZHS5_ORYSJ; Os02g0187700 protein
STRINGLOC_Os02g09480.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78938154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67300.16e-67myb domain protein r1